84-1377-26 NOV (Protein NOV Homolog, NovH, Insulin-like Growth Factor-binding Protein 9, IGF-binding Protein 9, IGFBP-9, IBP-9, Nephroblastoma Overexpressed Gene Protein Homolog, CCN Family Member 3, NOVH, IGFBP9, CCN3) 100ug 130481
84-1377-26 NOV (Protein NOV Homolog, NovH, Insulin-like Growth Factor-binding Protein 9, IGF-binding Protein 9, IGFBP-9, IBP-9, Nephroblastoma Overexpressed Gene Protein Homolog, CCN Family Member 3, NOVH, IGFBP9, CCN3) 100ug 130481
NOV is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins.
CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSKQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human NOV.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human NOV, aa1-357 (AAH15028.1).