NM2 is a heterodimeric protein functioning as a nucleoside diphosphate (NDP) kinase.
NME1 and NME2 comprise the 152 amino acid A and B polypeptide chains of the NM23 enzyme, respectively.
NME2 is identical to the beta subunit of human erythrocyte NDP kinase.
NDP kinases are involved in the synthesis of nucleoside triphosphates, and NM23 may act in the regulation of signal transduction by complexing with G proteins, causing activation/inactivation of developmental pathways.
NEM2 has been identified as a putative tumor suppressor.
High expression of mouse NME2 is detected in heart, liver, and kidney, with moderate expression in skeletal muscle, and negligible expression in other mouse tissues examined.
Applications:Suitable for use in Immunoprecipitation.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Serum
Purity：Serum
Form：Supplied as a liquid.
Specificity：Recognizes human NME2.
Isotype：IgG
Calc Applications Abbrev：IP
Calc Crossreactivity：Hu
Immunogen：Full length human NME2, aa1-152 (NP_002503.1).
