84-1376-26 NETO2 (BTCL2, Neuropilin and Tolloid-like Protein 2, Brain-specific Transmembrane Protein Containing 2 CUB and 1 LDL-receptor Class A Domains Protein 2, FLJ10430, FLJ14724, FLJ90456, NEOT2) 50ug 130294
84-1376-26 NETO2 (BTCL2, Neuropilin and Tolloid-like Protein 2, Brain-specific Transmembrane Protein Containing 2 CUB and 1 LDL-receptor Class A Domains Protein 2, FLJ10430, FLJ14724, FLJ90456, NEOT2) 50ug 130294
This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain.
It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis.
Alternatively spliced transcript variants have been observed, but they have not been fully characterized.
[provided by RefSeq].
Applications:Suitable for use in Immunofluorescence and Western Blot.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELDNYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human NETO2.
Isotype:IgG
Calc Applications Abbrev:IF WB
Calc Crossreactivity:Hu
Immunogen:Full length human NETO2, aa1-148 (AAH12381.1).