84-1375-29　NANOS2 (Nanos Homolog 2, NOS-2, NOS2) 50ug　130131

特徴

• Plays a key role in the sexual differentiation of germ cells by promoting the male fate but suppressing the female fate.
• Represses the female fate pathways by suppressing meiosis, which in turn results in the promotion of the male fate.
• Maintains the suppression of meiosis by preventing STRA8 expression, which is required for premeiotic DNA replication, after CYP26B1 is decreased.
• Regulates the localization of the CCR4-NOT deadenylation complex to P-bodies and plays a role in recruiting the complex to trigger the degradation of mRNAs involved in meiosis.
• Required for the maintenance of the spermatogonial stem cell population.
• Not essential for the assembly of P-bodies but is required for the maintenance of their normal state.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEIEEPSPGPPLGQDQGLGAPGANGGLGTLCNFCKHNGESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATGDQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.