Musashi 1, a neural RNA-binding protein, plays an important role in regulating cell differentiation in precursor cells.
Musashi 1 (Msi-1) has been shown to increase the accumulation of tau isoforms in intracellular inclusions in dementia and Parkinson's.
The presence of Msi-1 in a significant percentage of neurons containing cytoplasmic inclusions in 2 other neurodegenerative diseases Alzheimer's disease and Pick disease suggests that it may play a role in the pathogenesis of these neurodegenerative disorders.
Musashi 1 has also been detected in human tumor tissues such as gliomas and melanomas, suggesting its involvement in cancer development.
Msi-1 also appears to play be an vital role in the development of several types of carcinoma such as human hepatoma, and may be a useful molecular marker for tumor detection.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human MSI1.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human MSI1, aa1-362 (NP_002433.1).