84-1374-12 MS4A8B (Membrane-spanning 4-domains Subfamily A Member 8, Four-span Transmembrane Protein 4, Membrane-spanning 4-domains Subfamily A Member 8B, 4SPAN4, MS4A8B) 50ug 129914
84-1374-12 MS4A8B (Membrane-spanning 4-domains Subfamily A Member 8, Four-span Transmembrane Protein 4, Membrane-spanning 4-domains Subfamily A Member 8B, 4SPAN4, MS4A8B) 50ug 129914
This gene encodes a member of the membrane-spanning 4A gene family.
Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues.
The gene encoding this protein is localized to 11q12.3, among a cluster of family members.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGKTLGAIQIIIGLARIGLGSIMATVLVGEYLSISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIACASSHFGCQLVCCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSEIQANK
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human MS4A8B.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human MS4A8B, aa1-251 (AAH22895).