Band 11q23 chromosome locations are associated with approximately 10% of patients with acute lymphoblastic leukemia (ALL) and more than 5% of patients with acute myeloid leukemia (AML).
11q23 translocation associated leukemias typically jointly express lymphoid and myeloid markers and exhibit poor prognosis.
The gene at 11q23 involved in the translocations is known by multiple names, including ALL1, HRX, MLL, and TRX1.
One of the more infrequent translocations, t(11;17)(q23;q21), MLLT6, encodes a protein of 1,093aa, containing a leucine-zipper dimerization motif 3-prime to the fusion point and a cysteine-rich domain at the end terminus that can be arranged in 3 zinc fingers.
MMLT6 contains amino acid runs associated with domains involved in transcriptional repression or activation.
It has been proposed that MLLT6 represses truncated ALL1 function or inhibits function of the normal protein in leukemic cells.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MKEMVGGCCVCSDERGWAENPLVYCDGHACSVAVHQACYGIVQVPTGPWFCRKCESQERAARVRCELCPHKDGALKRTDNGGWAHVVCALYIPEVQFANVLTMEPIVLQYVPHDRFNKTCYICEEQGRESKAASGACMTCNRHGCRQAFHVTCAQMAGLLCEEEVLEVDNVKYCGYCKYHFSKMKTSRHSSGGGGGGAGGGGGSMGGGGSGFISGRRSRSASPSTQQEKHPTHHERGQKKSRKDKERLKQKHKKRPESPPSILTPPVVPTADKPRRGHQSPTNHGIGSLGCCLPDTPICLCPEGLSPGLLSAESGGRHSGLLSKF
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
Host：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human MLLT6.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human MLLT6, aa1-325 (AAH64612.1).
