84-1372-37 MGMT (O-6-Methylguanine DNA Methyltransferase, 6-O-Methylguanine DNA Methyltransferase, Methylated DNA Protein Cysteine Methyltransferase, Methylguanine DNA Methyltransferase, O-6-Methylguanine DNA Alkyltransferase) 50ug 129656
84-1372-37 MGMT (O-6-Methylguanine DNA Methyltransferase, 6-O-Methylguanine DNA Methyltransferase, Methylated DNA Protein Cysteine Methyltransferase, Methylguanine DNA Methyltransferase, O-6-Methylguanine DNA Alkyltransferase) 50ug 129656
MGMT is involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) in DNA.
This protein repairs alkylated guanine in DNA by stoichiometrically transferring the alkyl group at the O-6 position to a cysteine residue in the enzyme.
This is a suicide reaction: the protein is irreversibly inactivated.
Applications:Suitable for use in Immunofluorescence and Western Blot.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human MGMT.
Isotype:IgG
Calc Applications Abbrev:IF WB
Calc Crossreactivity:Hu
Immunogen:Full length human MGMT, aa1-207 (NP_002403.1).