Along with elastin, elaunin, oxytalan, and elastin-associated proteins fibrillin-1, microfibrillar-associated glycoprotein-1 (MAGP or MFAP-2) can be found within the juxtacanalicular tissue of the inner and outer walls and within the collector channel walls of human eyes perfused at low and high pressure, among other certain human tissues.
MAGP-1 (MFAP-2) is shown to play a significant role in the support and distensibility of the juxtacanalicular region of these collector channels.
It is also reported to inhibit LTB-1 binding to fibrillin-1, stimulate the phosphorylation of Smad2, and thereby mediate the subsequent extracellular deposition of latent TGFbeta.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MRAAYLFLLFLPAGLLAQGQYDLDPLPPFPDHVQYTHYSDQIDNPDYYDYQEVTPRPSEEQFQFQSQQQVQQEVIPAPTPEPGNAELEPTEPGPLDCREEQYPCTRLYSIHRPCKQCLNEVCFYSLRRVYVINKEICVRTVCAHEELLRADLCRDKFSKCGVMASSGLCQSVAASCARSCGSC
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
Host：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human MFAP2.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human MFAP2, aa1-183 (NP_002394.1).
