84-1371-11 MARCH2 (E3 Ubiquitin-protein Ligase MARCH2, Membrane-associated RING Finger Protein 2, Membrane-associated RING-CH Protein II, MARCH-II, RING Finger Protein 172, RNF172, HSPC240) 50ug 129427
84-1371-11 MARCH2 (E3 Ubiquitin-protein Ligase MARCH2, Membrane-associated RING Finger Protein 2, Membrane-associated RING-CH Protein II, MARCH-II, RING Finger Protein 172, RNF172, HSPC240) 50ug 129427
E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
MARCH2 may mediate ubiquitination of TFRC and CD86, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MTTGDCCHLPGSLCDCSGSPAFSKVVEATGLGPPQYVAQVTSRDGRLLSTVIRALDTPSDGPFCRICHEGANGECLLSPCGCTGTLGAVHKSCLEKWLSSSNTSYCELCHTEFAVEKRPRPLTEVSFRYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
Host：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human MARCH2.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human MARCH2, aa1-176 (NP_001005416.1).
