P38 beta is a member of the MAP kinase subfamily of Ser/Thr protein kinases.
MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development.
This kinase is closely related to p38 MAP kinase, both of which can be activated by changes in osmolarity of the extracellular environment, proinflammatory cytokines and cellular stress.
This protein preferentially phosphorylates transcription factor ATF2.
It is activated by phosphorylation on threonine and tyrosine by MKK6, and inhibited by pyridinyl-imidazole related compounds.
Highest levels of expression are found in the brain and heart, with additional expression in the placenta, lung, liver, skeletal muscle, kidney and pancreas.
Applications:Suitable for use in Western Blot and Immunoprecipitation.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Serum
Purity:Serum
Form:Supplied as a liquid.
Specificity:Recognizes human MAPK11.
Isotype:IgG
Calc Applications Abbrev:IP WB
Calc Crossreactivity:Hu
Immunogen:Full length human MAPK11, aa1-364 (NP_002742.3).