Leucine Zipper, Down-regulated in Cancer 1 (LDOC1) contains a leucine zipper-like motif and a proline-rich region that shares marked similarity with an SH3-binding domain.
The protein localizes to the nucleus and is down-regulated in some cancer cell lines.
It is thought to regulate the transcriptional response mediated by the nuclear factor kappa B (NF-kappaB).
The gene has been proposed as a tumor suppressor gene whose protein product may have an important role in the development and/or progression of some cancers.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDEEEEDDY
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human LDOC1.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human LDOC1, aa1-146 (NP_036449.1).