Recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and insulin receptors.
Once phosphorylated, functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins.
Role in G2-M progression in the cell cycle.
Represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP.
Also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export.
Isoform 3, which is expressed in growth-arrested cells only, inhibits S phase.
Applications:Suitable for use in Immunoprecipitation.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MQRRDDPAARMSRSSGRSGSMDPSGAHPSVRQTPSRQPPLPHRSRGGGGGSRGGARASPATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVKMEPENKYLPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEENYLDLFSHKNMKLKERVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPPPAPETYEEYVRNLNNVPFPST
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Serum
Purity:Serum
Form:Supplied as a liquid.
Specificity:Recognizes human KHDRBS1.
Isotype:IgG
Calc Applications Abbrev:IP
Calc Crossreactivity:Hu
Immunogen:Full-length human KHDRBS1, aa1-381 (AAH10132.1).