JUN is a basic domain leucine zipper protein (bZIP) that binds specific DNA sequence and belongs to AP-1 transcription factor family.
It forms either heterodimer or homodimer with other transcription activator proteins such as Fos, CREB, or other JUN proteins (JunB, JunD).
It is a short-lived protein with half-life of approximately 90 minutes and its gene was originally identified in ASV17 chicken retrovirus.
Transcription factor activity of JUN is induced when the protein is phosphorylated on Ser63 and Ser73 residues by c-JUN N-terminal kinase (JNK).
However, up-regulation of JUN is mediated by extracellular signal-regulated kinases (ERKs).
In addition, normal function of JUN protein is essential for cell cycle progression and entry into the S phase.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human JUN.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human JUN, aa1-331 (AAH68522.1).