The IL17 proteins are a family of potent cytokines that act to induce proinflammatory responses.
Studies have shown that IL17E binds strongly to IL17RB.
Receptor binding of ligand has been shown to lead to the activation of nuclear factor kappa-B and production of IL8.
Exposure of mice to IL17 resulted in a Th-2 like response characterized by increased serum IgE, IgG1 and IgA levels, blood eosinophilia, increased lymphocytes and neutrophils, and pathological changes in the tissues that included eosinophilic infiltrates, increased mucus production, B-lymphocyte hyperplasia and epithelial cell hyperplasia/hypertrophy.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MRERPRLGEDSSLISLFLQVVAFLAMVMGTHTYSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human IL17E.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human IL17E, aa1-177 (NP_073626).