84-1361-97 HMGA1 (High Mobility Group Protein HMG-I/HMG-Y, HMG-I(Y), High Mobility Group AT-hook Protein 1, High Mobility Group Protein A1, High Mobility Group Protein R, HMGIY, MGC12816, MGC4242, MGC4854) 50ug 127951
84-1361-97 HMGA1 (High Mobility Group Protein HMG-I/HMG-Y, HMG-I(Y), High Mobility Group AT-hook Protein 1, High Mobility Group Protein A1, High Mobility Group Protein R, HMGIY, MGC12816, MGC4242, MGC4854) 50ug 127951
It consists of a highly conserved AT-hook DNA-binding domain that mediates binding to AT-rich sequences in the minor groove of chromosomal DNA.
It functions as architectural chromatin-binding transcription factor altering the conformation of DNA by modulating nuclear protein-DNA complexes.
It is involved in many cellular processes including growth regulation, viral induction of beta-IFN gene and regulation of inducible gene transcription.
It also physically interacts with transcription factors such as AP-1, Sp-1 and CAAT:enhancer binding protein-beta to modulate their ability to activate gene expression.
It functions as a direct transcriptional target of c-Jun and c-Myc and is maximally expressed during embryonic development.
Pathological role of HMGA1 include integration of retroviruses into chromosomes and enhancing metastasis of tumor cells.
Applications:Suitable for use in Immunofluorescence and Western Blot.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human HMGA1.
Isotype:IgG
Calc Applications Abbrev:IF WB
Calc Crossreactivity:Hu
Immunogen:Full length human HMGA1, aa1-96 (AAH04924).