84-1361-72 HLA-DPB1 (HLA Class II Histocompatibility Antigen, DP beta 1 Chain, HLA Class II Histocompatibility Antigen, DP(W4) beta Chain, MHC Class II Antigen DPB1) 50ug 127916
84-1361-72 HLA-DPB1 (HLA Class II Histocompatibility Antigen, DP beta 1 Chain, HLA Class II Histocompatibility Antigen, DP(W4) beta Chain, MHC Class II Antigen DPB1) 50ug 127916
HLA-DPB belongs to the HLA class II beta chain paralogues.
This class II molecule is a heterodimer consisting of an alpha (DPA) and a beta chain (DPB), both anchored in the membrane.
It plays a central role in the immune system by presenting peptides derived from extracellular proteins.
Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages).
The beta chain is approximately 26-28 kDa and its gene contains 6 exons.
Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail.
Within the DP molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to 4 different molecules.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human HLA-DPB1.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human HLA-DPB1, aa1-258 (NP_002112.3).