84-1360-45 HADH2 (Hydroxyacyl-Coenzyme A Dehydrogenase Type II, AB-binding Alcohol Dehydrogenase, ABAD, CAMR, DUPXp11.22, ERAB, HCD2, HSD17B10, MHBD, Mitochondrial Ribonuclease P Protein 2, MRPP2, MRX17, MRX31, MRXS10, SCHAD, SDR5C1, Type II HADH, Type 10 17b-HSD, Type 10 17beta-hydroxysteroid Dehydrogenase, 17b-HSD10, XH98G2) 100ug 127709
84-1360-45 HADH2 (Hydroxyacyl-Coenzyme A Dehydrogenase Type II, AB-binding Alcohol Dehydrogenase, ABAD, CAMR, DUPXp11.22, ERAB, HCD2, HSD17B10, MHBD, Mitochondrial Ribonuclease P Protein 2, MRPP2, MRX17, MRX31, MRXS10, SCHAD, SDR5C1, Type II HADH, Type 10 17b-HSD, Type 10 17beta-hydroxysteroid Dehydrogenase, 17b-HSD10, XH98G2) 100ug 127709
HCD2 (Hydroxyacyl-Coenzyme A dehydrogenase) is a mitochondrial protein that catalyzes the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway.
ERAB is characterized as a NAD+-dependent dehydrogenase that overexpressed in neurons affected with Alzheimer's disease.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MAAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human HSD17B10.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human HSD17B10, aa1-261 (NP_004484.1).
