Lectins are carbohydrate binding proteins that interact with glycoprotein and glycolipids on the surface of animal cells.
The Galectins are lectins that recognize and interact with betagalactoside moieties.
Galactin-3 regulates a number of biological processes, including embryogenesis, inflammatory responses, cell progression and metastasis.
Galectin-3 can function intracellularly in controlling cell cycle and preventing T-cell apoptosis, and also extracellularly, in activating various cells, including monocytes/macrophages, mast cells, neutrophils, and lymphocytes.
Human Galectin-3 is a globular 26kD protein containing 250aa residues.
Applications:Suitable for use in Western Blot and Immunoprecipitation.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYHGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSAPGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Serum
Purity：Serum
Form：Supplied as a liquid.
Specificity：Recognizes human LGALS3. Species Crossreactivity: mouse.
Isotype：IgG
Calc Applications Abbrev：IP WB
Calc Crossreactivity：Hu Mo
Immunogen：Full length human LGALS3, aa1-250 (AAH53667.1).
