84-1356-59 GADD45G (CR6, DDIT2, Growth Arrest and DNA Damage-inducible Protein GADD45 gamma, Cytokine-responsive Protein CR6, DNA Damage-inducible Transcript 2 Protein, DDIT-2) 50ug 127094
84-1356-59 GADD45G (CR6, DDIT2, Growth Arrest and DNA Damage-inducible Protein GADD45 gamma, Cytokine-responsive Protein CR6, DNA Damage-inducible Transcript 2 Protein, DDIT-2) 50ug 127094
This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents.
The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase.
The GADD45G is highly expressed in placenta.
Applications:Suitable for use in Immunofluorescence and Western Blot.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human GADD45G.
Isotype:IgG
Calc Applications Abbrev:IF WB
Calc Crossreactivity:Hu
Immunogen:Full length human GADD45G, aa1-159 (NP_006696).