84-1354-91 FHL5 (Four and a Half LIM Domains Protein 5, FHL-5, Activator of cAMP-responsive Element Modulator in Testis, Activator of CREM in Testis, ACT, dJ393D12.2, FLJ33049, KIAA0776, RP3-393D12.2) 100ul 126812
84-1354-91 FHL5 (Four and a Half LIM Domains Protein 5, FHL-5, Activator of cAMP-responsive Element Modulator in Testis, Activator of CREM in Testis, ACT, dJ393D12.2, FLJ33049, KIAA0776, RP3-393D12.2) 100ul 126812
May be involved in the regulation of spermatogenesis.
Stimulates CREM transcriptional activity in a phosphorylation-independent manner.
Applications:Suitable for use in Immunoprecipitation and Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MTTAHFYCQYCTASLLGKKYVLKDDSPYCVTCYDRVFSNYCEECKKPIESDSKDLCYKDRHWHEGCFKCTKCNHSLVEKPFAAKDERLLCTECYSNECSSKCFHCKRTIMPGSRKMEFKGNYWHETCFVCENCRQPIGTKPLISKESGNYCVPCFEKEFAHYCNFCKKVITSGGITFCDQLWHKECFLCSDCRKDLCEEQFMSRDDYPFCMDCYNHLYANKCVACSKPISGLTGAKFICFQDSQWHSECFNCGKCSVSLVGKGFLTQNKEIFCQKCGSGMDTDI
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Serum
Purity：Serum
Form：Supplied as a liquid.
Specificity：Recognizes human FHL5.
Isotype：IgG
Calc Applications Abbrev：IP WB
Calc Crossreactivity：Hu Rb
Immunogen：Full length human FHL5, aa1-284 (AAH21723.1).
