Acts as a transcriptional transactivator of ELL and ELL2 elongation activities.
Applications:Suitable for use in Immunofluorescence, Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 10ug/mlImmunohistochemistry (Formalin fixed paraffin embedded): 3ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MNGTANPLLDREEHCLRLGESFEKRPRASFHTIRYDFKPASIDTSCEGELQVGKGDEVTITLPHIPGSTPPMTVFKGNKRPYQKDCVLIINHDTGEFVLEKLSSSIQVKKTRAEGSSKIQARMEQQPTRPPQTSQPPPPPPPMPFRAPTKPPVGPKTSPLKDNPSPEPQLDDIKRELRAEVDIIEQMSSSSGSSSSDSESSSGSDDDSSSSGGEDNGPASPPQPSHQQPYNSRPAVANGTSRPQGSNQLMNALRNDLQLSESGSDSDD
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human EAF1.
Isotype:IgG
Calc Applications Abbrev:IF IHC WB
Calc Crossreactivity:Hu
Immunogen:Full length human EAF1, aa1-268 (AAH41329.1).