84-1349-34 DIRAS1 (GBTS1, RIG, GTP-binding Protein Di-Ras1, Distinct Subgroup of the Ras Family Member 1, Ras-related Inhibitor of Cell Growth, Small GTP-binding Tumor Suppressor 1, FLJ42681) 50ug 125855
84-1349-34 DIRAS1 (GBTS1, RIG, GTP-binding Protein Di-Ras1, Distinct Subgroup of the Ras Family Member 1, Ras-related Inhibitor of Cell Growth, Small GTP-binding Tumor Suppressor 1, FLJ42681) 50ug 125855
DIRAS1 belongs to a distinct branch of the functionally diverse Ras (see HRAS; MIM 190020) superfamily of monomeric GTPases.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGHAFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREVDTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGKRSGKQKRTDRVKGKCTLM
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
Host：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human DIRAS1.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human DIRAS1, aa1-198 (NP_660156.1).
