84-1348-22　DCTD (Deoxycytidylate Deaminase, dCMP Deaminase) 100ug　125678

特徴

• Deoxycytidylate deaminase (DCTD; EC 3.5.4.12) catalyzes the deamination of dCMP to dUMP, thus providing the nucleotide substrate for thymidylate synthase (MIM 188350).
• DCTD is allosterically activated by dCTP and inhibited by dTTP [supplied by OMIM].
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MVGGGQPCGPNMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.