A non-glycosylated secreted protein and member of the type 2 cystatin superfamily, which acts as a potent inhibitor of both endogenous and pathogenic cysteine proteinases.
Cystatin C is produced by nucleated cells and is present in a variety of biological fluids.
Changes in cystatin C have been associated with a number of cardiovascular diseases, including atherosclerosis and myocardial infarction, and measurement of plasma cystatin C levels can be used as a more sensitive marker than creatinine for determining glomerular filtration rate (GFR) in the kidneys.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human CST3.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human CST3, aa1-146 (NP_000090.1).
