Human CX3CR1 has been shown to mediate both the adhesive and migratory functions of fractalkine.
Fractalkine and CX 3 CR1 represent new types of leukocyte trafficking regulators.
Applications:Suitable for use in Immunofluorescence.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 1ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSKKPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFITVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYPEVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVFFLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKFRRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.4.
Specificity:Recognizes human CX3CR1.
Isotype:IgG
Calc Applications Abbrev:IF
Calc Crossreactivity:Hu
Immunogen:Full length recombinant protein corresponding to aa1-355 from human CX3CR1.