84-1344-76　CLEC5A (C-type Lectin Domain Family 5 Member A, C-type Lectin Superfamily Member 5, Myeloid DAP12-associating Lectin 1, MDL-1, CLECSF5, MDL1, MGC138304) 50ug　125070

特徴

• Functions as a positive regulator of osteoclastogenesis.
• Cell surface receptor that signals via TYROBP.
• Regulates inflammatory responses.
• Acts as a key regulator of synovial injury and bone erosion during autoimmune joint inflammation.
• Critical macrophage receptor for dengue virus serotypes 1-4.
• The binding of dengue virus to CLEC5A triggers signaling through the phosphylation of TYROBP, this interaction does not result in viral entry, but stimulates proinflammatory cytokine release.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilutions:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.