84-1344-75　CLEC4D (C-type Lectin Domain Family 4, Member D, C-type Lectin Superfamily Member 8, C-type Lectin-like Receptor 6, CLEC-6, CLECSF8, MCL, MGC40078, MPCL) 50ug　125067

特徴

• CLEC4D (C-type lectin domain family 4 member D), also known as CLCSF8, CLEC-6, and MCL, is a 30kD type II transmembrane (TM) glycoprotein that belongs to the CLR (C-type Lectin Receptor) family of molecules.
• It is synthesized as a 215aa protein that contains a 17aa N-terminal cytoplasmic domain, a 21aa TM segment, and a 177aa C-terminal extracellular region.
• The extracellular region shows a short stalk and a 118aa CRD (carbohydrate recognition domain).
• The nature of its carbohydrate ligand is unknown.
• CLEC4D is restricted to monocytes/macrophages and serves as an endocytic receptor.
• Homodimers and homotrimers form on the cell surface.
• The human CLEC4D extracellular region shares 63% aa sequence identity with the mouse extracellular region.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MGLEKPQSKLEGGMHPQLIPSVIAVVFILLLSVCFIASCLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.