Tight junctions are specialized regions of cell-cell contact that are particularly abundant in luminal epithelial cell sheets.
In freeze-fracture electron micrographs, tight junctions are visualized as belt-like bands of anastomosing sealing strands (TJ strands) that completely encircle the lateral surfaces of each cell.
TJ strands on adjacent cells are presumed to interact with each other to form a sort of "molecular gasket" that prevents ions, water and other molecules from leaking between cells and thus, from one side of the sheet to the other.
In addition to this so-called "barrier" function, the "fence" function of tight junctions plays an important role in maintaining epithelial cell-polarity by blocking the diffusion of membrane proteins between apical (luminal) and basolateral cell surfaces.
Claudin-7 is localized in the intercellular junctions of the epithelial cells of the proximal tubules of the nephrons in mammalian kidney1.
It is reportedly down regulated in head and neck squamous cell carcinomas2.
Claudin-7 is also expressed in normal human and mouse epithelia.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLATLVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRAPRSYPKSNSSKEYV
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Serum
Purity：Serum
Form：Supplied as a liquid.
Specificity：Recognizes human CLDN7.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human CLDN7, aa1-211 (NP_001298.2).
