84-1344-27 CHMP1A (CHMP1, KIAA0047, PCOLN3, PRSM1, Charged Multivesicular Body Protein 1a, Chromatin-modifying Protein 1a, Vacuolar Protein Sorting-associated Protein 46-1) 50ug 124955
84-1344-27 CHMP1A (CHMP1, KIAA0047, PCOLN3, PRSM1, Charged Multivesicular Body Protein 1a, Chromatin-modifying Protein 1a, Vacuolar Protein Sorting-associated Protein 46-1) 50ug 124955
This gene encodes a member of the CHMP/Chmp family of proteins which are involved in multivesicular body sorting of proteins to the interiors of lysosomes.
The initial prediction of the protein sequence encoded by this gene suggested that the encoded protein was a metallopeptidase.
The nomenclature has been updated recently to reflect the correct biological function of this encoded protein.
Applications:Suitable for use in Immunofluorescence and Western Blot.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALLQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSTMDLQKVSSVMDRFEQQVQNLDVHTSVMEDSMSSATTLTTPQEQVDSLIMQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.