CD99 or MIC2 gene product, or E2 antigen is expressed in the cell membrane of some lymphocytes, cortical thymocytes, and granulosa cells of the ovary.
The antigen is also expressed by most pancreatic islet cells, Sertoli cells of the testis and some endothelial cells.
Mature granulocytes express very little or no CD99.
MIC2 is strongly expressed on Ewing's sarcoma cells and primitive peripheral neuroectodermal tumors.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human CD99. Species Crossreactivity: mouse.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Mo
Immunogen：Full length human CD99, aa1-185 (NP_002405.1).
