Regulated progression through the cell cycle requires sequential expression of a family of proteins called cyclins.
Upon their induction, cyclins form complexes with specific cyclin-dependent kinases (CDKs), creating active holoenzymes that phosphorylate target proteins required for cell-cycle progression.
In humans, the CDK/Cyclin H complex regulates the CDK-activating kinase (CAK).
CAK is involved in activation of RNA polymerase II when complexed with the core-TFIIH basal transcription factor, allowing for elongation of transcripts.
However, the function of the Cyclin H ortholog in zebrafish has not yet been isolated.
One study has shown Cyclin H to be present throughout early stages of development, and experiments with defective Cyclin H suggest that it plays a vital role in this area.
Applications:Suitable for use in Immunofluorescence and Western Blot.
Other applications not tested.
Recommended Dilution:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
AA Sequence:MYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human CCNH.
Isotype:IgG
Calc Applications Abbrev:IF WB
Calc Crossreactivity:Hu
Immunogen:Full length human CCNH, aa1-323 (NP_001230.1).