84-1341-33　CCL27 (ILC, SCYA27, C-C Motif Chemokine 27, CC Chemokine ILC, Cutaneous T-cell-attracting Chemokine, ESkine, IL-11 R-alpha-locus Chemokine, Skinkine, Small-inducible Cytokine A27) 100ug　124465

特徴

• This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9.
• Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes.
• The CC cytokines are proteins characterized by two adjacent cysteines.
• The protein encoded by this gene is chemotactic for skin-associated memory T lymphocytes.
• This cytokine may also play a role in mediating homing of lymphocytes to cutaneous sites.
• It specifically binds to chemokine receptor 10 (CCR10).
• Studies of a similar murine protein indicate that these protein-receptor interactions have a pivotal role in T cell-mediated skin inflammation.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MKGPPTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for at least 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.