This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9.
Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes.
The CC cytokines are proteins characterized by two adjacent cysteines.
Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis.
This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils.
The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs.
It is a high affinity functional ligand for chemokine receptor 7 (CCR7) that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19).
[provided by RefSeq].
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human CCL21.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human CCL21, aa1-134 (NP_002980.1).