Antimicrobial peptides (AMP) are effector molecules of the innate immune system with direct antimicrobioal and immunomodulatory effects.
AMP are produced by epithelial and professional host defense cells such as macrophages or neutrophils.
AMP directly inactivate microorganisms and, in addition, have diverse activities on various cell types.
In mammals, peptides of the defensin and the cathelicidin families are found.
hCAP-18 is the only cathelicidin present in humans.
hCAP-18 is a 170aa cathelicidin microbial precursor protein that is proteolytically processed to yield the antibacterial peptide LL-37.
The precursor hCAP-18 is found in the specific granules of neutrophils and is expressed in many immune and epithelial cells.
Cathelicidin has an established role in host defense.
In addition to their direct antimicrobial function, cathelicidin peptides are involved in the modulation of repair and tissue homeostasis, epithelial wound healing, chemoattraction of immune cells, and release of inflammatory mediators from epithelial cells.
Recent studies also found that LL-37 significantly regulates endocytic capacity, modifies expression of phagocytic receptors, increases secretion of Th1-inducing cytokines of dendritic cells (DC) generated from blood monocytes, and modulates the response of monocytes and DC to toll like receptor (TLR)-ligands.
Moreover LL-37 also modulates the response of neutrophils to bacterial activation.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human CAMP.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human CAMP, aa1-170 (NP_004336.2).