84-1339-41　NSMCE2 (E3 SUMO-protein Ligase NSE2, MMS21 Homolog, hMMS21, Non-structural Maintenance of Chromosomes Element 2 Homolog, Non-SMC Element 2 Homolog, C8orf36, MMS21, FLJ32440) 50ug　124161

特徴

• The structural maintenance of chromosomes (SMC) family of proteins play essential roles in genomic stability.
• Nse1 and Nse2 are essential proteins and conserved from yeast to man and loss of function leads to similar terminal phenotypes to those observed for Smc5-6 inactivation.
• Data suggests that like Smc5-6, Nse1, and Nse2 function in the homologous recombination repair of DNA double strand breaks.
• Applications:Suitable for use in Immunofluorescence and Western Blot.
• Other applications not tested.
• Recommended Dilution:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MPGRSSSNSGSTGFISFSGVESALSSLKNFQACINSGMDTASSVALDLVESQTEVSSEYSMDKAMVEFATLDRQLNHYVKAVQSTINHVKEERPEKIPDLKLLVEKKFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDEDIIVTQSQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKKRHRHSE
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.