84-1339-21　C3aR (C3a Anaphylatoxin Chemotactic Receptor, C3a-R, C3AR1, AZ3B, C3R1, HNFAG09) 100ug　124131

特徴

• C3a is an anaphylatoxin generated through activation of the complement C3.
• C3a is a potent chemoattractant for phagocytes, and it stimulates chemotaxis and other leukocyte functions.
• C3a binds to eosinophils, basophils, neutrophils, and differentiated U937 cells, that all express receptors for C3a on their cell surface.
• The C3a receptor has been cloned and shown to be a G protein-coupled receptor with seven putative transmembrane domains.
• This receptor is characterized for its large extracellular loop between the fourth and fifth transmembrane domains.
• The loop can be readily detected using the rabbit anti-C3a receptor antibody.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilutions:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDRCLVVFKPIWCQNHRNVGMACSICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSSSLDYPDFYGDPLENRSLENIVQPPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSADSLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHETSPLDNSDAFLSTHLKLFPSASSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSVIMIACYSFIVFRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVCIALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCPSNNVISERNSTTV
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.