Brain-specific kinase 1 (BRSK1; SAD-B) and Brain-specific kinase 2 (BRSK2; SAD-A) are serine/threonine kinases closely related to AMPK.
LKB1 phosphorylates Thr189 in the T-loop of BRSK1 and Thr174 in the T-loop of BRSK2, resulting in activation of the kinases.
BRSK1 localizes to synaptic vesicles in the hippocampus and cerebellum, together with the active zone proteins Bassoon and CAST, and BRSK1 phoshorylates the active zone protein RIM1.
An alternatively spliced from of BRSK1 displays unique activity during the cell cycle, phosphorylating Ser131 of γ-tubulin and controling centrosome duplication.
Neuronal polarization, including axon formation, is fundamental for normal brain development.
BRSK1 -/- and BRSK2 -/- mice have defects in neuronal polarity and impaired corticogenesis.
Knockdown of BRSK1 and BRSK2 in vitro diminishes axonal growth.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MSNLTPESSPELAKKSWFGNFISLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTHDPPAAQHLSEPPPPAPGLSWGAGLKGQKVATSYESSL
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
Host：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human BRSK2.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human BRSK2, aa1-170 (AAH24291.1).
