Bcl-w is a pro-survival (apoptotic) member of the Bcl-2 family; a family involved in the regulation of cellular apoptosis at the mitochondrion.
Relative to its Bcl-2 counterparts there is considerably less data on this prticular protein.
Studies of the related gene in mice indicated a role in the survival of NGF- and BDNF-dependent neurons.
Mutation and knockout studies of the mouse gene demonstrated an essential role in adult spermatogenesis.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2.
Specificity:Recognizes human BCL2L2.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human BCL2L2, aa1-193 (NP_004041.1).