84-1335-13　Apolipoprotein AI (Apo AI, ApoA-I, Apolipoprotein A1, APOA1) 50ug　123442

特徴

• Apolipoprotein AI promotes cholesterol efflux from tissues to the liver for excretion.
• Apolipoprotein AI is the major protein component of high density lipoprotein (HDL) in the plasma.
• Synthesized in the liver and small intestine, it consists of two identical chains of 77aa; an 18aa signal peptide is removed co-translationally and a 6aa propeptide is cleaved post-translationally.
• Apolipoprotein A I is a cofactor for lecithin cholesterolacyltransferase (LCAT) which is responsible for the formation of most plasma cholesteryl esters.
• Defects in the Apolipoprotein A I gene are associated with HDL deficiency and Tangier disease.
• The therapeutic potential of apoA-I has been recently assessed in patients with acute coronary syndromes, using a recombinant form of a naturally occurring variant of apoA-I.
• The availability of recombinant normal apoA-I should facilitate further investigation into the potential usefulness of apoA-I in preventing atherosclerotic vascular diseases.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.