84-1333-36 AKR1E2 (AKR1CL2, 1,5-anhydro-D-fructose Reductase, AF Reductase, Aldo-keto Reductase Family 1 Member C-like Protein 2, Aldo-keto Reductase Family 1 Member E2, LoopADR, Testis-specific Protein, hTSP, AKRDC1, MGC10612) 50ug 123170
84-1333-36 AKR1E2 (AKR1CL2, 1,5-anhydro-D-fructose Reductase, AF Reductase, Aldo-keto Reductase Family 1 Member C-like Protein 2, Aldo-keto Reductase Family 1 Member E2, LoopADR, Testis-specific Protein, hTSP, AKRDC1, MGC10612) 50ug 123170
AKR1E2 catalyzes the NADPH-dependent reduction of 1,5-anhydro-D-fructose (AF) to 1,5-anhydro-D-glucitol.
Can also catalyze the reduction of various aldehydes and quinones (By similarity).
Has low NADPH-dependent reductase activity towards 9,10-phenanthrenequinone (in vitro).
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLNRNLRLAMFPM
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for at least 12 months.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
Host：mouse
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2.
Specificity：Recognizes human AKR1CL2. Species Crossreactivity: mouse.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Mo
Immunogen：Full length human AKR1CL2, aa1-307 (AAH02862.1).
