The A2a Adenosine Receptor is a major target of caffeine.
This receptor inhibits cell aggregation, induces vasodilation, and downregulates inflammation.
The A2a receptor has been reported to be expressed in brain, embryo, heart, lung, and vessel.
ESTs have been isolated from B-cell/lung/testis, blood, brain, colon, embryo, heart/melanocyte/uterus, kidney, liver/spleen, lung, skeletal muscle, testis, and tonsil libraries.
Applications:Suitable for use in Flow Cytometry and Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size:50ug
Host:mouse
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.4.
Specificity:Recognizes human ADORA2A.
Isotype:IgG
Calc Applications Abbrev:FC WB
Calc Crossreactivity:Hu
Immunogen:Full-length protein corresponding to aa1-412 from human ADORA2A.