84-1331-50　ACOT8 (ACTEIII, PTE1, PTE2, Acyl-coenzyme A Thioesterase 8, Acyl-CoA Thioesterase 8, Choloyl-coenzyme A Thioesterase, HIV-Nef-associated Acyl-CoA Thioesterase, PTE-2, Peroxisomal Acyl-coenzyme A Thioester Hydrolase 1, Peroxisomal Long-chain Acyl-CoA Thioesterase 1, Thioesterase II) 50ug　122883

特徴

• Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH.
• It may mediate Nef-induced down-regulation of CD4.
• It may be involved in the metabolic regulation of peroxisome proliferation.
• Applications:Suitable for use in Immunofluorescence and Western Blot.
• Other applications not tested.
• Recommended Dilutions:Immunofluorescence: 10ug/mlOptimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTVLNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKLPVLYQVERTRTGSSFSVRSVKAVQHGKPIFICQASFQQAQPSPMQHQFSMPTVPPPEELLDCETLIDQYLRDPNLQKRYPLALNRIAAQEVPIEIKPVNPSPLSQLQRMEPKQMFWVRARGYIGEGDMKMHCCVAAYISDYAFLGTALLPHQWQHKVHFMVSLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRQDGVLAVTCAQEGVIRVKPQVSESKL
• Storage and Stability:May be stored at 4°C for short-term only.
• Aliquot to avoid repeated freezing and thawing.
• Store at -20°C.
• Aliquots are stable for 12 months after receipt.
• For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.