Nod (CARD4) is a cytosolic pattern recognition molecule (PRRs) of the NLR (NOD-like receptor) family.
Nod1 is widely expressed by many cell types and is implicated in sensing meso-diaminopimelic acid (meso-DAP)-containing PGN fragments, which are present in most Gramnegative bacteria and certain Gram-positive ones, like the Bacillus species.
Upon activation, Nod1 initiates a pro-inflammatory response through NF-kappa signaling and is a key receptors in epithelial cells where it controls infections via the gastrointestinal system.
Mutations in Nod1 have been reported to confer susceptibility to several inflammatory disorders including inflammatory bowel disease, atopic eczema and asthma.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 1:1000Optimal dilutions to be determined by researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：50ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by epitope affinity chromatography.
Form：Supplied as a liquid in PBS, 0.02% sodium azide, 10% glycerol.
Specificity：Recognizes human Nod1.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa2-31 (EEQGHSEMEIIPSESHPHIQLLKSNRELLV) of human Nod1.
