Neuromedin S is a 36aa neuropeptide found in the brain of humans and other mammals.
It is produced in the suprachiasmatic nucleus of the hypothalamus and is related to neuromedin U.
It is thought to be involved in regulation of circadian rhythm and also has appetite suppressant effects, as well as regulating the release of several other peptide hormones including vasopressin, luteinizing hormone and oxytocin.
Applications:Suitable for use in ELISA.
Other applications not tested.
Recommended Dilution:ELISA (peptide): 1:1600 Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O and PBS.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：200ug
Host：rabbit
Source Antibody：mouse
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography
Form：Supplied as a lyophilized powder from PBS, pH 7.5. Reconstitute with 115ul ddH2O and 85ul PBS.
Specificity：Recognizes mouse Neuromedin S.
Isotype：IgG
Calc Applications Abbrev：E
Calc Crossreactivity：Mo
Immunogen：Synthetic peptide corresponding to aa70-103 of mouse prepro-Neuromedin S (FLFHYSRTRKPTHPVSAEFAPVHPLMRLAAKLAS).
