LYZL6 belongs to the glycosyl hydrolase 22 family.
The exact function of LYZL6 remains unknown.
Applications:Suitable for use in Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Immunohistochemistry: 1:20-1:50 using formalin-fixed, paraffin-embedded sections.
Most normal tissues and malignant tissues were negative.
Subsets of cells in seminiferus ducts expressed strong cytoplasmic positivity while the urothelium displayed moderate staining.
Placenta, some of the glandular cells in gastrointestinal tract, epididymis and seminal vesicles showed weak staining.
Occasional malignant carcinoids, urothelial and colorectal cancers showed weak to moderate staining
Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2, 0.02% sodium azide, 40% glycerol.
Specificity：Recognizes human Lysozyme-like 6.
Isotype：IgG
Calc Applications Abbrev：IHC
Calc Crossreactivity：Hu
Immunogen：Lysozyme-like protein 6 Precursor recombinant protein epitope signature tag (PrEST), immunogen sequence CNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRP
