Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans.
GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1).
GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion
When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection.
GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake.
GLP-2 and related analogs may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy.
Applications:Suitable for use in ELISA.
Other applications not tested.
Recommended Dilutions:ELISA: 1:3000Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Serum
Purity:Serum.
Form:Supplied as a lyophilized powder, 137mM D-mannitol. Reconstitute with 100ul sterile ddH2O.
Specificity:Recognizes human Glucagon like Peptide-2.
Isotype:IgG
Calc Applications Abbrev:E
Calc Crossreactivity:Hu
Immunogen:Synthetic peptide corresponding to aa126-158, HADGSFSDEMNTILDNLAARDFINWLIQTKITD of human GLP-2, conjugated to KLH.