Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans.
GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1).
GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion
When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection.
GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake.
GLP-2 and related analogs may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy.
Applications:Suitable for use in ELISA.
Other applications not tested.
Recommended Dilutions:ELISA: 1:3000Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized and reconstituted products are stable for 12 months after receipt at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：20ul
Host：rabbit
Source Antibody：human
Grade：Serum
Purity：Serum.
Form：Supplied as a lyophilized powder, 137mM D-mannitol. Reconstitute with 100ul sterile ddH2O.
Specificity：Recognizes human Glucagon like Peptide-2.
Isotype：IgG
Calc Applications Abbrev：E
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa126-158, HADGSFSDEMNTILDNLAARDFINWLIQTKITD of human GLP-2, conjugated to KLH.
