Cytokines play an important role in inflammation and immunity.
Macrophage migration inhibitory factor (MIF) was one of the first cytokine activities described and is a proinflammatory cytokine that plays an important role in systemic inflammatory events.
MIF’s cytokine activity was initially described as a T cell-derived factor that inhibited the random migration of macrophages, hence its name.
Since it was cloned and expressed in pure form, MIF’s activities have been established to play many roles in development and various disease states.
For example, MIF is released from macrophages and T cells in response to physiological concentrations of glucocorticoids.
The secreted MIF counterregulates the immunosuppressive effects of steroids on immune cell activation and cytokine production.
In in vitro experiments MIF is significantly upregulated by the stimulation of lipopolysaccharide (LPS) using 10pg/ml-10ng/ml of LPS and reaches the maximum 12h after the stimulation.
MIF also prevents cleavage of Bax into an 18kD active fragment, and, consequently, reduces activation of the critical effector caspase 3, suggesting that MIF inhibits apoptosis pathways proximal to mitochondria activation and is therefore a survival factor.
And, MIF is also known to exhibit enzymatic activities.
A pathologic role for MIF has been described in many conditions including arthritis, asthma, and inflammatory bowel disease, and may also play a role in the control of cell growth in certain cancers.
Consequently, MIF is suggested to be a potential therapeutic target for human diseases.
Applications:Suitable for use in ELISA, Neutralization and Western Blot.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：500ug
Host：chicken
Source Antibody：human
Grade：Highly Purified
Purity：Purified by selective precipitation and salt fractionation followed by extensive dialysis. Endotoxin: <10pg/ul by LAL method.
Form：Supplied as a lyophilized powder in PBS, pH 7.2, 0.01% sodium azide. No stabilizing proteins added. Reconstitute with 500ul sterile ddH2O.
Specificity：Recognizes human mature Migration Inhibitory Factor, Macrophage (MIF) at 12.3kD. The MIF gene encodes a protein of 115aa. The initiating methionine is cleaved leaving a mature protein of 114aa.
Isotype：IgY
Calc Applications Abbrev：E WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa2-32 of Human MIF (KLH coupled). Peptide sequence: PMFIVNTNVPRASVPDGFLSELTQQLAQATG
