TRAIL (also known as Apo-2L) is a member of the tumor necrosis factor (TNF) ligand family that rapidly induces apoptosis in a variety of transformed cell lines.
A distinct receptor for TRAIL, TRAIL-R3, is restricted to peripheral blood lymphocytes (PBLs) and skeletal muscle.
All three TRAIL receptors bind TRAIL with similar affinity, suggesting a complex regulation of TRAIL-mediated signals
Applications:Suitable for use in Flow Cytometry, ELISA, Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:ELISA: 1:25,000Western Blot: 1:150Immunohistochemistry (paraffin): 1:25Flow Cytometry: 2ul per 10e6 cells in 100ul Optimal dilutions to be determined by the researcher.
Storage and Stability:May be stored at 4°C for short-term only.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Aliquots are stable for 12 months after receipt.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
仕様
Size：200ug
Host：goat
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2, 1mg/ml BSA, 0.09% sodium azide.
Specificity：Recognizes human TRAIL-R3; crossreacts <0.2% with TRAIL-R2 peptide of the same region; not likely to bind TRAIL-R1 due to low sequence homology in this region; may bind to TRAIL-R4. Species Crossreactivity: mouse and chimpanzee
Isotype：IgG
Calc Applications Abbrev：E FC IHC WB
Calc Crossreactivity：Hu Mo
Immunogen：Synthetic peptide corresponding to aa33-63, EVPQQTVAPQQQRHSFKGEECPAGSHRSEHTC, from the extracellular domain sequence of human TRAIL-R3.
